{"title":"ENGAGEMENT RINGS","description":"\u003cp data-section-id=\"1nee6ov\" data-start=\"317\" data-end=\"350\"\u003eVintage engagement rings – jewelry with a history. Vintage engagement rings are unique jewelry from the past that combines the romantic symbolism of engagement with the craftsmanship of old-world jewelry making.\u003cbr data-start=\"559\" data-end=\"562\"\u003eIn the Syncret collection, you will find carefully selected vintage engagement rings made of gold and adorned with diamonds or natural precious stones. Each vintage engagement ring is unique – it was created in a different era and exists only as a single piece. Old jewelry was often handcrafted, which is why it stands out with details and proportions that are difficult to find in contemporary jewelry production. The collection includes both antique engagement rings and pre-owned or pre-loved jewelry – carefully selected pieces with a history that can begin a new chapter as a symbol of modern love.\u003c\/p\u003e\n\u003cp data-section-id=\"wbincq\" data-start=\"1245\" data-end=\"1284\"\u003eIs a vintage engagement ring a good choice? Yes. A vintage engagement ring is unique and often handcrafted, which gives it character and the jewelry craftsmanship of bygone eras.\u003c\/p\u003e\n\u003cp data-section-id=\"1jyyuno\" data-start=\"1504\" data-end=\"1579\"\u003eHow does a vintage ring differ from a new engagement ring? A vintage ring was created in the past and has a history and style characteristic of its era, while contemporary rings are produced according to current jewelry trends.\u003c\/p\u003e\n\u003cp data-section-id=\"1dawoni\" data-start=\"1779\" data-end=\"1822\"\u003eIs vintage jewelry authentic? Yes. Vintage jewelry consists of authentic jewelry pieces from past decades that have been carefully selected and have retained their aesthetic and collectible value.\u003c\/p\u003e\n\u003cp data-section-id=\"w48opu\" data-start=\"2003\" data-end=\"2041\"\u003eAre vintage rings durable? Yes. Old jewelry was often made from high-quality gold and natural precious stones, which is why many pieces have remained in excellent condition despite the passage of years.\u003c\/p\u003e","products":[{"product_id":"zloty-pierscionek-z-brylantem-w-starym-szlifie-vintage","title":"Old cut diamond gold ring, Vintage","description":"\u003cp\u003eThis ring dates from a time when diamonds were shaped slowly, with the stone being guided by hand, not by machine. The central old-cut brilliant has retained the stone's inner life – inclusions and irregular facets, which in old jewelry making were seen as a natural part of its identity. The brilliance here is subdued, multi-layered, best revealed in soft light.\u003c\/p\u003e\n\u003cp\u003eThe stone is set in a distinctive, architectural hexagonal setting, enriched with subtle ornamental details characteristic of the early 20th century. This type of crown was designed not only as a safeguard for the brilliant, but as its frame, a form that organizes light and directs attention to the center.\u003c\/p\u003e\n\u003cp\u003eThe ring is made of 750 white gold. The band seamlessly transitions into the setting, revealing manual craftsmanship and a workshop approach to form. This is jewelry for people who seek authenticity, history, and a calm, unobtrusive presence in an engagement or collector's ring.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 750 \/ 16","offer_id":56733917806927,"sku":"0030000631","price":4790.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/Zlotypierscionekzbrylantemwstarymszlifie_Vintage_2.png?v=1767374950"},{"product_id":"platynowy-pierscionek-zareczynowy-z-brylantem-1-5-ct-vintage","title":"Platinum engagement ring with 1.5 ct diamond, Vintage","description":"\u003cp\u003eOne diamond, but what a diamond! A brilliant-cut diamond weighing 1.55 ct, with VVS clarity and J color, is a true king among stones. And it's no coincidence that it's set in a crown-like setting, after all, every king deserves a proper place.\u003c\/p\u003e\n\u003cp\u003eThe geometric form gives the piece character; it's elegant, but with a touch of originality. The 0.950 platinum band adds a cool luster to the ring, which beautifully highlights the warm hue of the diamond. The minimalist design makes the whole piece timeless, but with that one detail that catches the eye, because details are what matter.\u003c\/p\u003e\n\u003cp\u003eThis is jewelry for someone who appreciates simplicity but likes it when there's more to a classic form.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Platinum 950 \/ 18","offer_id":56736418890063,"sku":"0020002482","price":69990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/Platynowypierscionekzareczynowyzbrylantem1.5ct_Vintage_2.webp?v=1767439961"},{"product_id":"zloty-pierscionek-daisy-z-brylantami-2-ct-vintage","title":"Daisy Diamond Ring 2 ct, Vintage","description":"\u003cp data-start=\"0\" data-end=\"545\"\u003eSeven diamonds arranged in the shape of a blooming flower form a \u003cem data-start=\"78\" data-end=\"85\"\u003edaisy\u003c\/em\u003e-type composition – a motif particularly popular in jewelry from the turn of the 19th and 20th centuries, when jewelers eagerly drew upon nature's symbols, imbuing them with meaning beyond mere decoration. This ring brings to mind a wood anemone: delicate, yet deeply rooted in ancient beliefs. In ancient Rome, these plants were thought to protect against diseases and evil influences, which is why their images appeared in amulets and objects worn close to the body.\u003c\/p\u003e\n\u003cp data-start=\"547\" data-end=\"877\"\u003eThe diamonds, with a total weight of approximately 2 ct, are set in a classic, floral crown that allows the stones to interact with light with every movement of the hand. \u003c\/p\u003e\n\u003cp data-start=\"879\" data-end=\"1272\"\u003eThe ring's gold shank was made in an expandable form, which was a practical but rarely seen solution. Such a mechanism significantly facilitates putting on and taking off jewelry for people with wider finger joints, without compromising the overall aesthetics. This is a detail that reveals the experience of an old master, thinking not only about form but also about everyday wearing comfort.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 585 \/ 12","offer_id":56736496517455,"sku":"0010001571","price":32500.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/ZlotypierscionekDaisyzbrylantami2ct_Vintage_2.webp?v=1767442222"},{"product_id":"zloty-pierscionek-z-diamentami-2-18-ct-vintage","title":"Gold ring with 2.18 ct diamonds, Vintage","description":"\u003cp\u003eThis ring catches the eye like a star in the night sky. At its center shines a dazzling diamond, full of brilliance, surrounded by a subtle aura of smaller stones that amplify its light. This is the \u003cem\u003ehalo\u003c\/em\u003e effect, a jewelry trick that has been captivating the hearts of jewelry lovers for decades. Thanks to it, the central stone appears larger, and the entire piece takes on a spectacular character.\u003c\/p\u003e\n\u003cp\u003eHandcrafted in the 1970s or 80s, this ring is a true style icon of its time. With a total diamond weight of over 2 ct, it is the quintessence of elegance and timeless beauty. \u003c\/p\u003e\n\u003cp\u003eWill it become an engagement ring, a symbol of a lifelong promise? Or perhaps a unique treasure in the collection of someone who loves vintage? One thing is certain, this is jewelry that not only adorns but also tells a story. Perhaps soon it will be part of yours? \u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 500 \/ 17","offer_id":56736692011343,"sku":"0020002645","price":56990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/Zlotypierscionekzdiamentami2.18ct_Vintage_2.webp?v=1767445303"},{"product_id":"zloty-pierscionek-z-diamentami-i-motywem-koniczyny-vintage","title":"Platinum Ring with Diamonds and Clover Motif, Vintage","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eCrafted from platinum, this early\/mid-20th-century ring captivates with its unique design—a three-leaf clover adorned with old brilliant and eight-cut diamonds. This timeless motif, though subtle, carries deeply rooted symbolism: the three leaves of a clover have for centuries been associated with faith, hope, and love, values that in the \u003cem\u003ebelle époque\u003c\/em\u003e and Edwardian eras were conveyed more subtly than today, but no less genuinely.\u003c\/p\u003e\n\u003cp\u003eThe small diamonds have been meticulously set to capture the natural softness of the leaf shape, as if freezing the moment the clover swayed in the wind. The subtle asymmetry lends a lightness to the piece that cannot be replicated in modern designs.\u003c\/p\u003e\n\u003cp\u003eThis is jewelry that wasn't merely designed, but narrated. Within its platinum contour lies not only exquisite craftsmanship and artistic intuition, but also a gesture, as if someone, long ago, gifted another a small amulet of everyday happiness.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Platinum 950 \/ 11","offer_id":56756620722511,"sku":"0020004539","price":4890.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/Platynowypierscionekzdiamentamiimotywemkoniczyny_Vintage_1.webp?v=1767614905"},{"product_id":"zloty-pierscionek-z-diamentami-ok-3-ct-i-podwojnym-halo-vintage","title":"Gold ring with diamonds approx. 3 ct and double halo, Vintage","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eA captivating diamond weighing as much as 1.17 ct is set in this unique ring design, inspired by the solar system and unexplored cosmic spaces. Diamonds, like planets, orbit around the sparkling central diamond.\u003c\/p\u003e\n\u003cp data-pm-slice=\"1 1 []\"\u003eGaze deep into this galactic vision, and you will discern the beauty of precious stones and the highest craftsmanship. Made in the second half of the 20th century.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 375 \/ 15","offer_id":56756973502799,"sku":"0020003036","price":34990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/Zlotypierscionekzdiamentamiok.3ctipodwojnymhalo_Vintage_2.webp?v=1767618226"},{"product_id":"platynowy-pierscionek-z-trzema-brylantami-vintage","title":"Platinum three-diamond ring, Art Deco","description":"\u003cp\u003eThe three diamonds set in the central line of this ring tell a universal story: past, present, and future. This symbolism was beloved by 20th-century jewelers, and it was particularly popular in engagement jewelry, which was meant to remind us of the enduring nature of feelings regardless of the passage of time.\u003c\/p\u003e\n\u003cp\u003eIn the piece presented, three central brilliant-cut diamonds are set in intricate platinum bezels, a metal valued not only for its durability but also for the nobility of its cool hue. The band narrows towards the top, where it is additionally adorned on both sides with a row of small, hand-set diamonds. On one side, three of them remain intact. On the other, one has disappeared, leaving behind an empty setting. However, this is not a flaw – it is a trace of time, physical proof that the ring lived another story before.\u003c\/p\u003e\n\u003cp\u003eThis detail does not disrupt the harmony of the composition; rather, it enriches it with a touch of melancholy. For does not every love story carry with it some unspoken element?\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Platinum 850 \/ 11","offer_id":56757002305871,"sku":"0020004534","price":22490.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/Platynowypierscionekztrzemabrylantami_Vintage_1.webp?v=1767618807"},{"product_id":"zloty-pierscionek-z-diamentami-ok-2-ct-art-deco-nowy-jork","title":"Art Deco gold ring with diamonds approx. 2 ct, New York","description":"\u003cp\u003eNew York in the 1920s and 1930s was a city of rhythm, light, and ambition. Skyscrapers grew at an unprecedented pace, and the Art Deco aesthetic organized the chaos of modernity into symmetry and clear geometry. This ring was created precisely in that spirit, as a jewelry equivalent of urban architecture and the jazz energy of the era.\u003c\/p\u003e\n\u003cp data-end=\"804\" data-start=\"349\"\u003eThe composition, based on three diamonds with a total weight of over 2 ct, refers to the classic arrangement characteristic of American Art Deco. The central, slightly larger stone is set in a regular mounting and flanked by two side diamonds, creating a distinct rhythm and visual balance. The whole is complemented by an intricate wreath of smaller diamonds, which adds depth and subtle decorativeness to the form without disturbing its disciplined character.\u003c\/p\u003e\n\u003cp data-end=\"1136\" data-start=\"806\"\u003eThe gold and cool tone of the metal harmonize here with the precision of the setting and the clarity of the proportions. This ring was designed for the city that never sleeps, for a woman confident in her position and aware of the power of modern elegance. An object unequivocally rooted in its era, yet legible and relevant after almost a hundred years.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 585 \/ 14","offer_id":56757072200015,"sku":"0020002618","price":49890.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/Zlotypierscionekzdiamentamiok.2ct_ArtDeco_NowyJork_2.webp?v=1767619659"},{"product_id":"zloty-pierscionek-z-brylantem-zsrr-kijow-1971-r","title":"Gold ring with diamond, USSR Kyiv 1971","description":"\u003cp data-start=\"11\" data-end=\"332\"\u003eThis ring was created in the 1970s in Kyiv, one of the significant artistic centers of the then Soviet Union. The design's form reflects the aesthetics of late modernism, where simplicity and functionality combined with the discreet elegance characteristic of the Eastern European jewelry school.\u003c\/p\u003e\n\u003cp data-start=\"334\" data-end=\"730\"\u003eThe centrally set diamond, weighing 0.27 ct, with SI1 clarity and G color, stands out with good brilliance and light. The butter setting, inspired by the shape of gently opened petals, enhances the stone's optical sparkle and makes the diamond appear to float above the shank. The warm gold band, tapering towards the center, further directs attention to the central point of the composition.\u003c\/p\u003e\n\u003cp data-start=\"732\" data-end=\"1002\"\u003eJewelry from this period was a response to the realities of the era, focusing on solid craftsmanship, restrained form, and thoughtful detail. This ring remains an example of moderate luxury, where technical precision and regional history create a cohesive, timeless whole.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Rose gold 585 \/ 23.5","offer_id":56768475464015,"sku":"0020004415","price":2990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/Zlotypierscionekzbrylantem_ZSRRKijow1971r._1.png?v=1774960407"},{"product_id":"zloty-pierscionek-art-deco-z-szafirem-syntetycznym-ok-8-ct-i-diamentami","title":"Art Deco gold ring with approx. 8 ct synthetic sapphire and diamonds","description":"\u003cp\u003ePenetrating blues, geometric forms, and intricate ornamentation – this ring is a perfect example of the Art Deco style, which revolutionized jewelry in the 1920s and 1930s. Made of 750 white gold, it captivates with a balance between monumental form and precisely refined details.\u003c\/p\u003e\n\u003cp\u003eThe central point of the composition is a synthetic sapphire weighing an impressive 8 ct, cut in a classic cushion cut. Its deep, mesmerizing shade of navy blue perfectly contrasts with the cool sparkle of the diamonds. Next to it, in an intricately decorated setting, brilliant-cut and rose-cut diamonds totaling approximately 0.54 ct gleam, arranged in an openwork structure that emphasizes the architectural character of the ring.\u003c\/p\u003e\n\u003cp\u003eThe design of this era was inspired by both modernity and the influences of ancient cultures, including the exoticism of the Middle East and the austere elegance of classical Greece. This is evident in the rich geometric adornments of the band and the filigree details, which give the ring lightness despite its distinctive form.\u003c\/p\u003e\n\u003cp\u003eThis type of jewelry was created for women who were not afraid to stand out, strong, independent, keeping pace with the jazz and modernist era. Today, such a ring is not only an ornament but also a record of aesthetic transformations that forever changed the world of jewelry.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 750 \/ 18","offer_id":56771092349263,"sku":"0030000362","price":14990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0030000362ZlotypierscionekArtDecozszafiremsyntetycznymok.8ctidiamentami_1.webp?v=1767803947"},{"product_id":"zloty-pierscionek-z-kamieniami-syntetycznymi-w-kolorze-ametystu-vintage","title":"Gold ring with synthetic amethyst-colored stones, Vintage","description":"\u003cp\u003eRemember those old movies where the heroine would discover extraordinary jewelry in an antique casket? This ring is just such a treasure. Its golden settings and purple stones tell a story that you can become a part of. This combination of tradition and modernity makes this ring timeless. Put it on and feel like the heroine of a romantic novel.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow gold 585 \/ 19","offer_id":56776329101647,"sku":"0020004022","price":990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020004022Pierscionekzkamieniamisyntetycznymiwkolorzeametystu_Vintage_1.webp?v=1767869255"},{"product_id":"zloty-pierscionek-toi-et-moi-z-brylantami-1-ct-lata-90-te-xx-w","title":"Diamond Toi et Moi gold ring 1 ct, 1990s","description":"\u003cp data-start=\"10\" data-end=\"367\"\u003eThe \u003cem\u003eToi et Moi\u003c\/em\u003e motif is one of the most significant symbols in the history of jewelry. Two stones set on a single band have been interpreted as a sign of relationship, partnership, and balance for over two centuries. In this ring, the classic idea was reinterpreted at the end of the 20th century in a simplified, more utilitarian form, devoid of excessive decoration.\u003c\/p\u003e\n\u003cp data-start=\"369\" data-end=\"766\"\u003eThe ring is made of 585 yellow gold. At the center of the composition are two brilliant-cut diamonds, each weighing approximately 0.50 ct. The diamonds are set slightly at an angle to each other, so that the line of the band naturally transitions into the settings, in accordance with the classic principle of the \u003cem\u003eToi et Moi\u003c\/em\u003e form.\u003c\/p\u003e\n\u003cp data-start=\"768\" data-end=\"1067\"\u003eThe 1990s brought a turn towards simplicity and the meaning of the object. This ring retains historical symbolism while foregoing ornamentation in favor of pure form and a clear message. It is an example of jewelry where sentiment meets a modern approach to design.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow gold 585 \/ 20","offer_id":56776360198479,"sku":"0020004448","price":5990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/ZlotypierscionekToietMoizbrylantami1ct_lata90-teXXw._1.png?v=1774954270"},{"product_id":"zloty-pierscionek-toi-et-moi-z-diamentami-0-50-ct-lata-50-te-holandia","title":"Toi et Moi gold ring with 0.50 ct diamonds, 1950s, Netherlands","description":"\u003cp\u003eSome rings have more than just sparkle; they tell a story. This is the case with this unique \u003cem\u003eToi et Moi\u003c\/em\u003e ring, whose name literally means \u003cem\u003eYou and I\u003c\/em\u003e. It's a design known for centuries, chosen by lovers as a symbol of two souls forever united.\u003c\/p\u003e\n\u003cp\u003eIts crossover design, featuring two old mine cut diamonds, evokes classic engagement rings of the past – elegant, meaningful, and timelessly charming. A similar model was worn by Joséphine Bonaparte herself when Napoleon gave her such a ring as a token of eternal love.\u003c\/p\u003e\n\u003cp\u003eThis Dutch piece, hallmarked after 1955, combines the romanticism of yesteryear with the precision of goldsmith craftsmanship.\u003c\/p\u003e\n\u003cp\u003eIt's a piece of jewelry that tells a love story – will it be part of yours?\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow gold 585 \/ 7","offer_id":56776379040079,"sku":"0020003665","price":10090.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020003665ZlotypierscionekToietMoizdiamentami0.50ct_lata50-te_Holandia_2.webp?v=1767870506"},{"product_id":"zloty-pierscionek-zareczynowy-z-diamentem-ii-polowa-xx-wieku-paryz","title":"Gold diamond engagement ring, second half of the 20th century, Paris","description":"\u003cp\u003eWe present to you a diamond ring, the essence of French chic! Made in Paris in the second half of the 20th century, it carries the spirit of the city of love, art, and elegance.\u003c\/p\u003e\n\u003cp\u003eSome would say it's the perfect engagement ring; after all, diamonds have symbolized permanence and eternity for centuries. But it can also be something more, the beginning of a unique collection, the first step into the world of jewelry that will accompany you throughout your life. Just like in the 18th century, when Marie Antoinette received her first diamond ring, which later became part of her legendary collection.\u003c\/p\u003e\n\u003cp\u003eSo, whether it's a symbol of love or simply an expression of your own style, one thing is certain: this Parisian ring is a small work of art that will tell your story. \u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow gold 750 \/ 7","offer_id":56776403288399,"sku":"0020003052","price":2690.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020003052pierscionekzareczynowyzdiamentem_IIpolowaXXwieku_Paryz_2.webp?v=1767871275"},{"product_id":"zloty-pierscionek-z-rubinami-i-brylantami-i-pol-xx-w","title":"Gold ring with rubies and brilliant-cut diamonds, first half of 20th century.","description":"\u003cp\u003eIn this composition, two worlds intertwine: the fiery glow of rubies and the cool light of antique diamonds, as if a goldsmith, working in a small workshop in the first decades of the 20th century, tried to capture the movement of a dance he had just seen outside a ballroom window. The delicate, winding line of the setting in 624 gold and silver immediately reveals the fascination with Art Nouveau: the softness, asymmetry, and organic rhythm of an era that rejected simple geometry in favor of forms inspired by nature.\u003c\/p\u003e\n\u003cp\u003eRubies, meticulously cut into calibrated shapes, form a line reminiscent of a glowing thread in fabric; above and below them, a trio of old-cut diamonds are set in silver, giving their light a subtly subdued, almost intimate character. It is a sparkle akin to that of gas lamps reflecting on wet cobblestones—delicate, enigmatic, inviting a prolonged gaze.\u003c\/p\u003e\n\u003cp\u003eThe entire piece bears the hallmarks of a goldsmith's handiwork, for whom every millimeter was as important as the facade's line was to Art Nouveau architects: fluid, vibrant, never accidental. This ring is a testament to an era when jewelry not only adorned but also engaged in its own dialogue with nature, light, and movement.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow gold 624 + Silver \/ 11","offer_id":56776634106191,"sku":"0030000586","price":3590.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/Zlotypierscionekzrubinamiibrylantami_Ipol.XXw._2.png?v=1767874839"},{"product_id":"zloty-pierscionek-daisy-z-szafirem-i-diamentami-vintage","title":"Daisy's Gold Ring with Sapphire and Diamonds, Vintage","description":"\u003cp\u003eIn old goldsmith workshops, the \u003cem\u003eDaisy\u003c\/em\u003e motif was associated with elegance that didn't require complicated gestures. A single stone, intensely blue, as deep as the evening sky after rain, was enough to create the center of the composition, around which an elaborate crown of diamonds was built. This is how rings were created, endowed not only with harmony but also with a kind of soft light.\u003c\/p\u003e\n\u003cp\u003eThe central sapphire, set in 750 gold, is surrounded by a border of old-cut diamonds, set in a silver bezel, a technique characteristic of jewelry from decades ago. The combination of two metals was not due to whim but to practice: silver could bring out the brilliance of diamonds more fully than gold, and craftsmen gladly took advantage of this phenomenon.\u003c\/p\u003e\n\u003cp\u003eThis is a subtle composition in the aesthetic of a classic \u003cem\u003ecluster ring\u003c\/em\u003e, popular since the turn of the 19th and 20th centuries. The ring has retained everything that is most important in this form: balance, purity of lines, and stones that, despite the passage of time, carry their original, undiminished brilliance.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow gold 744 + Silver \/ 20","offer_id":56776961229135,"sku":"0020004705","price":7590.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/ZlotypierscionekDaisyzszafiremidiamentami_Vintage_2.png?v=1767877992"},{"product_id":"zloty-pierscionek-z-tanzanitem-i-brylantami","title":"Gold ring with tanzanite and diamonds","description":"\u003cp\u003eThis ring will certainly attract the attention of those who appreciate the combination of tradition with modernity. Its design refers to the Victorian marquise style, and the central point is an unusual tanzanite, a stone discovered only in the second half of the 20th century. Tanzanite gained recognition thanks to its unique blue-violet color and rarity. It is worth noting that tanzanite is mined in only one place in the world, in Tanzania, and its most beautiful specimens achieve collector's value.\u003c\/p\u003e\n\u003cp\u003eThe presented ring is characterized by a delicate construction, adorned with small white brilliant-cut diamonds. These diamonds are partially set on the shank and form a double halo around the tanzanite, emphasizing its brilliance. The openwork gallery further allows for ideal illumination of the stones, which enhances their natural sparkle. The whole creates the impression of an elegant, shimmering jewel that delights with its sophisticated style.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow gold 0.585 \/ 11","offer_id":56778472915279,"sku":"0020004304","price":7990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020004304Zlotypierscionekztanzanitemibrylantami_1.webp?v=1767888459"},{"product_id":"zloty-pierscionek-z-brylantem-w-starym-szlifie-ii-pol-xx-w-krakow","title":"Gold ring with an old-cut diamond, second half of the 20th century, Krakow","description":"\u003cp\u003eIn Krakow's goldsmith workshops of the 1960s and 1970s, the tradition of manual craftsmanship was still vibrant, passed down from master to apprentice in cramped workshops smelling of wax, flux, and heated metal. It was there, in an era when goldsmithing remained one of the last enclaves of individual artistic work, that this ring was created—modest in form, yet full of elegance rooted in thoughtful proportion and the subtle sparkle of an old cut.\u003c\/p\u003e\n\u003cp\u003eThe diamond, weighing 0.78 ct, encased in a silver crown, reveals the full extent of its character only in light, where tiny reflections and discreet flashes dance, reminiscent of flickering candles in the concert hall of the Krakow Philharmonic. \u003c\/p\u003e\n\u003cp\u003eThe setting was handmade – gold was combined with silver, according to a tradition dating back to the 19th century, when silver best showcased the cool brilliance of precious stones. Such metal combinations are increasingly rare today, which makes their authenticity all the more valuable.\u003c\/p\u003e\n\u003cp\u003eOn the inner side of the band is the mark of the master TH, a trace of the specific goldsmith who made this piece, perhaps to special order. This is jewelry that carries not only a stone, but also the history of a place, a time, and the hand that created it.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow Gold 0.585 + Silver \/ 18","offer_id":56778582098255,"sku":"0020004367","price":10990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020004367Zlotypierscionekzbrylantemwstarymszlifie_IIpol.XXw._Krakow_1.webp?v=1767889598"},{"product_id":"zloty-pierscionek-z-diamentem-1-25-ct-1910-rok","title":"Gold ring with 1.25 ct diamond, 1910","description":"\u003cp\u003e\u003cspan\u003eThe presented ring is made of gold, and a high-quality diamond weighing over one carat is set in a platinum setting. The basket-shaped white metal setting allows good illumination of the brilliant, making it exceptionally bright and shiny. On the hand, the ring simply \"shines.\" The shank, made of rose, warm gold, beautifully complements natural skin tones. On its inner side, there is an inscription \u003cem\u003e1.14.64\u003c\/em\u003e (implying the year 1964) and another, slightly worn engraving \u003cem\u003eW.P 1910\u003c\/em\u003e, so we can assume that this is a family heirloom that was passed on to a new owner after more than half a century. This is a real treat for collectors of historical jewelry and a ring with a story.\u003c\/span\u003e\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow Gold 0.585 + Platinum \/ 16","offer_id":56778959683919,"sku":"0020004186","price":63990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020004186Zlotypierscionekzdiamentem1.25ct_1910rok_2.webp?v=1767890515"},{"product_id":"zloty-pierscionek-z-brylantem-1-33-ct-vintage","title":"Gold ring with a 1.33 ct diamond, Vintage","description":"\u003cp\u003eMinimalism with a clear narrative – this is how one can describe this vintage ring from the turn of the 1980s and 1990s. The central 1.33 ct brilliant-cut diamond is set in a distinctive six-prong crown, whose form refers to classic European patterns, popular in designs of the late 20th century.\u003c\/p\u003e\n\u003cp\u003eThe ring bears Polish hallmarks from the era, confirming the legality of the metal, though not necessarily its place of origin. This is an important detail, as many precious items from this period were also made to private order, often outside the country, and then hallmarked for circulation in Poland.\u003c\/p\u003e\n\u003cp\u003eThe brilliant-cut diamond, the sole and main protagonist of the composition, presents itself without unnecessary additions. Its full brilliant cut, stability of setting, and proportions create a design that is austere, noble, and perfectly universal. Jewelry created in the spirit of the turn of the century, where not the effect, but the essence mattered.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 0.585 \/ 15","offer_id":56779202986319,"sku":"0020004535","price":23590.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020004535Zlotypierscionekzbrylantem1.33ct_Vintage_1.webp?v=1767891339"},{"product_id":"zloty-pierscionek-z-brylantem-0-55-ct-vintage","title":"Gold ring with a 0.55 ct diamond, Vintage","description":"\u003cp data-start=\"10\" data-381\"\u003eIn the 1990s, European jewelry increasingly gravitated towards simplicity, without compromising on craftsmanship or the nobility of materials. This ring perfectly embodies the spirit of that decade. A slender 585 white gold shank guides the eye towards a classic six-prong setting, cradling a 0.55 ct brilliant cut diamond.\u003c\/p\u003e\n\u003cp data-start=\"383\" data-654\"\u003eThe central stone, with its round brilliant cut and well-preserved proportions, has been left without additional decorative settings. Its brilliance defines the entire composition, and the understated form allows attention to focus solely on the diamond's quality and how it interacts with light.\u003c\/p\u003e\n\u003cp data-start=\"656\" data-1022\"\u003eThe use of white gold, particularly popular in the 1990s, lends the ring a modern character while retaining classic elegance. This vintage jewelry features clean lines and a balanced form, making it an ideal engagement ring, built on simplicity, proportion, and the significance of a single, central stone.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 0.585 \/ 10.5","offer_id":56779340349775,"sku":"0020004533","price":8590.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020004533Zlotypierscionekzbrylantem0.55ct_Vintage_1.webp?v=1767891806"},{"product_id":"zloty-pierscionek-z-brylantami-1-20-ct-i-rozowym-szafirem-vintage","title":"Diamond 1.20 ct and Pink Sapphire Gold Ring, Vintage","description":"\u003cp\u003eThe history of Daisy rings is full of elegance and royal charm. Just recall Princess Diana's legendary engagement ring – a daisy-shaped model, with a blue sapphire shining at its heart, surrounded by diamonds like flower petals. It's a classic, timeless and always on-trend.\u003c\/p\u003e\n\u003cp\u003eOur ring follows in the footsteps of this jewelry icon, but with a touch of its own romantic character. The pink sapphire, centrally set in this delicate composition, gives it extraordinary subtlety and lightness. This stone has symbolized love, gentleness, and harmony for centuries, and its powdery hue perfectly contrasts with the brilliant-cut diamonds, which add sparkle and prestige.\u003c\/p\u003e\n\u003cp\u003eCrafted from white 14-karat gold, this ring is a dream piece of jewelry for fans of unique details. Perfect for an engagement or a special gift. Because classic beauty in its finest form never fades; it endures and delights, just like this ring.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 585 \/ 16","offer_id":56779450089807,"sku":"0020003667","price":20790.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020003667Zlotypierscionekzbrylantami1.20ctirozowymszafirem_Vintage_2.webp?v=1767894050"},{"product_id":"zloty-pierscionek-z-diamentami-1-78-ct-i-polowa-xx-wieku","title":"Daisy ring in gold with 1.78 ct diamonds, 1st half of the 20th century","description":"\u003cp\u003eThere are rings that have more than just sparkle; they carry a story and character. This model, crafted from 0.735 white gold, is precisely one such case. Classic, yet with a touch of originality that makes it hard to look away.\u003c\/p\u003e\n\u003cp\u003eAt the center of the composition, an old-cut diamond gleams, its brilliance possessing that unique depth not found in modern stones. It is these subtle imperfections in the cut that give it character and warmth. Smaller diamonds are arranged around the central stone, forming a subtle, slightly modified halo. The overall design alludes to the classic \u003cem\u003eDaisy\u003c\/em\u003e model, but with a modern twist that adds lightness and freshness.\u003c\/p\u003e\n\u003cp\u003eDiamonds with a total weight of 1.78 ct ensure the ring sparkles from every angle, yet in an understated manner. This is jewelry that doesn't shout; rather, it discreetly reminds us that true elegance lies in the details.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 735 \/ 11","offer_id":56779477090639,"sku":"0020003818","price":19490.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/pierscionekztrzemabrylantami_kopia_kopia_kopia_1.webp?v=1775731501"},{"product_id":"platynowy-pierscionek-z-diamentami-w-starym-szlifie-vintage","title":"Platinum ring with old cut diamonds, Vintage Retro","description":"\u003cp\u003eEvery ring has its own story. This one, perhaps, was an engagement gift, or a souvenir of an important event. The platinum from which it was made was then reserved for the most special occasions. Three diamonds, each with a different cut, testify to the skill of the jeweler who created this small work of art.\u003c\/p\u003e\n\u003cp\u003eInterestingly, the number three has always held special significance. In ancient Egypt, it symbolized the divine triad, in Greece – the three Moirae spinning the threads of human life, and in Rome – the three gods ruling the world. In this ring, the three diamonds can symbolize the past, present, and future, or perhaps the three most important values in its owner's life – love, friendship, and faith. Each of us can give these three diamonds our own meaning.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Platinum 950 \/ 17","offer_id":56779493343567,"sku":"0020004018","price":11990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020004018Platynowypierscionekzdiamentamiwstarymszlifie_Vintage_2.webp?v=1767894853"},{"product_id":"zloty-pierscionek-z-brylantami-krakow-1986-2004","title":"Gold ring with diamonds, Krakow 1986-2004","description":"\u003cp\u003eIn times when Poland was transitioning from the end of the People's Republic of Poland to a free-market reality, and Krakow's goldsmith workshops continuously operated, nurturing the artistry of old masters, this unconventional project emerged. The two-diamond ring, with an asymmetrical yet harmonious line, was crafted from 583 purity gold, typical of Eastern European jewelry from the late 20th century.\u003c\/p\u003e\n\u003cp\u003eTwo diamonds, set securely and geometrically enclosed, do not compete with each other; rather, they engage in a silent conversation. Perhaps they are like two different perspectives on the same matter, two decades, or two poles of one story. This composition deviates from the classic engagement aesthetic, yet precisely for this reason, it attracts individuals who value designs with soul and a sense of time.\u003c\/p\u003e\n\u003cp\u003eThe characteristic curve of the band and the minimalist form place this model within the aesthetic of late modernism, a movement that embraced function with love but did not forgo beauty. For connoisseurs: this is jewelry rooted in tradition, but designed with the future in mind.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow Gold 0.585 \/ 16.5","offer_id":56785983144271,"sku":"0020004445","price":3690.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020004445Zlotypierscionekzbrylantami_Krakow1986-2004_1.webp?v=1767956008"},{"product_id":"zloty-pierscionek-z-brylantami-1-52-ct-bukiet-kwiatow-vintage","title":"Diamond ring 1.52 ct \"Bouquet of Flowers\", Vintage","description":"\u003cp\u003eImagine a bouquet of flowers, but one that never withers, full of sparkle, elegance, and timeless charm. This is exactly what this extraordinary ring with an opening shank is, adorned with diamonds totaling 1.52 ct (clarity Si\/P1, color H). Its form alludes to \u003cem\u003eGiardinetti\u003c\/em\u003e, a garden motif that has captivated jewelry for centuries.\u003c\/p\u003e\n\u003cp\u003eIn the 18th and 19th centuries, garden-inspired rings were a symbol of romanticism, nature, and subtle elegance. Their intricately set stones were meant to resemble blooming buds, and this ring is a perfect example of this tradition, delicate yet expressive, like a spring bouquet encased in a golden setting.\u003c\/p\u003e\n\u003cp\u003eIt is not just jewelry, but a true story hidden in the form and brilliance of diamonds. A perfect choice for someone who values uniqueness, finesse, and a touch of magic.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 0.585 \/ 12","offer_id":56786074927439,"sku":"0020003286","price":15990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020003286Zlotypierscionekzbrylantami1.52ctBukietKwiatow_Vintage_2.webp?v=1767958122"},{"product_id":"zloty-pierscionek-z-rozowymi-kamieniami-i-diamentami-inspirowany-stylem-georgianskim","title":"A Georgian-inspired gold ring with pink stones and diamonds","description":"\u003cp\u003eThis ring captures the spirit of the Georgian era, a time when jewelry not only adorned but also told stories of status, emotions, and refined taste. Although created in the second half of the 20th century, it was deliberately subjected to an aging process, both in terms of metal finish and stone selection, to give the impression of an authentic jewel worn for generations.\u003c\/p\u003e\n\u003cp\u003eThe form of the ring refers to the classic aesthetics of the late 18th and early 19th centuries: the composition is low, wide, and horizontally built, a typical example of a \u003cem\u003ecluster ring\u003c\/em\u003e, where central stones are surrounded by a regular border of small diamonds. The yellow gold band has a slightly irregular surface and a muted luster, which further enhances the antique effect.\u003c\/p\u003e\n\u003cp\u003eAttention is drawn to the pink stones with a warm, pastel hue, set in closed, full bezels—a detail typical of Georgian precious items, allowing the light passing through the stone to be exposed despite its flat cut. The surrounding table-cut and rose-cut diamonds are a precise nod to the jewelry technique of that time, as modern brilliant cuts were not yet known in the Georgian era.\u003c\/p\u003e\n\u003cp\u003eThis ring does not pretend to be a contemporary interpretation – it has been consciously styled as if it has survived centuries.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow gold 0.585 \/ 17","offer_id":56786092360015,"sku":"0030000526","price":4990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0030000526Zlotypierscionekzrozowymikamieniamiidiamentamiinspirowanystylemgeorgianskim_1.webp?v=1767958629"},{"product_id":"zloty-pierscionek-ze-szmaragdem-i-diamentami-modern-art-deco","title":"Gold ring with emerald and diamonds, Modern Art Deco","description":"\u003cp\u003eThis project clearly demonstrates a dialogue with Art Deco aesthetics, not as a reconstruction of old designs, but as their contemporary, more sculptural interpretation. The architectural arrangement of forms, the contrast between glossy and matte surfaces, and the use of two independent compositional axes create jewelry that looks like a miniature fragment of a modernist facade.\u003c\/p\u003e\n\u003cp\u003eThe central emerald, with its rich, vibrant color, is set in a way that emphasizes its \"inner energy.\" The stone doesn't dominate but works in concert with the rest of the structure, especially with the semi-circular element that, like an arc of light, encircles some of the diamonds. These, in turn, are arranged like rhythmic points of light on a modernist staircase, guiding the eye along the lines of the ring.\u003c\/p\u003e\n\u003cp\u003eMost interesting, however, is the way the jeweler treated the band: split into two parallel arms, it resembles an engineering design where each element is functional and aware of its role. This open construction emphasizes the spatiality of the entire composition, revealing inspiration from 1930s architecture translated into the language of contemporary jewelry.\u003c\/p\u003e\n\u003cp\u003eThe 750 white gold gives the whole a cool, sophisticated tone, and the mirrored surfaces act like frames reflecting the green of the emerald. This is a ring that not only carries an echo of Art Deco but incorporates it into a 21st-century sensibility: decisive, geometric, yet full of light.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 750 \/ 14","offer_id":56786172903759,"sku":"0030000607","price":8590.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0030000607pierscionekzeszmaragdemidiamentami_ModernArtDeco_3.png?v=1767959306"},{"product_id":"zloty-pierscionek-ze-szmaragdem-i-diamentami-art-deco","title":"Art Deco Gold Ring with Emerald and Diamonds","description":"\u003cp\u003eThis handcrafted Art Deco ring is a manifestation of the geometric harmony and jewelry artistry of the 1920s and 1930s, a time when jewelry was not only meant to sparkle but also to resonate with the architecture and art of the era.\u003c\/p\u003e\n\u003cp\u003eAt the center of the composition is an emerald of intense, saturated color, in an elegant emerald cut. Its architectural form perfectly aligns with the principles of Art Deco style: simplicity of line, symmetry, and the power of detail. Flanking the emerald are small, irregularly shimmering, single-cut diamonds, contrasting with the precise, glassy surface of the central stone.\u003c\/p\u003e\n\u003cp\u003eParticular attention is drawn to the sides of the band, adorned with hand-engraved ornamentation, subtle yet resolute, as if to remind us that even surfaces not immediately visible deserve artistry.\u003c\/p\u003e\n\u003cp\u003eThis is not a ring that tries to attract attention. It is an object that speaks with the voice of the interwar years: clear, decisive, yet with a hint of melancholy. A perfect combination of emerald depth, diamond light, and artisanal precision.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 750 \/ 17","offer_id":56786202493263,"sku":"0030000525","price":11990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0030000525ZlotypierscionekzeszmaragdemidiamentamiArtDeco_1.webp?v=1767959718"},{"product_id":"zloty-pierscionek-z-diamentami-i-rubinami-art-deco","title":"Art Deco gold ring with diamonds and rubies","description":"\u003cp\u003eIn the 1920s, the world was changing at an unprecedented pace. The bustle of New York streets bathed in neon lights, jazz clubs pulsating with music, and women who for the first time felt truly free – all of this was reflected in the jewelry of the Art Deco era. Geometric lines, bold contrasts, and a love for precision created a style that remains a symbol of luxury and modernity to this day.\u003c\/p\u003e\n\u003cp\u003eThis extraordinary ring, crafted from 18-carat gold, is like a time capsule, transporting us to an era of glitter and elegance. Its structure resembles the facades of modern skyscrapers, perfectly symmetrical, with a clear division into segments. The central diamond, set with subtle milgrain, emanates light, as if reflecting thousands of lights of Art Deco Paris. Flanking it are deep, blood-red rubies, stones that in the 1920s symbolized courage and passion, so characteristic of women of that time.\u003c\/p\u003e\n\u003cp\u003eDelicate yet decisive side lines, set with smaller rose-cut diamonds, complete the piece, making the ring seem to dance in the light, like a cabaret star on the stage of the Moulin Rouge. Every detail of this composition evokes the elegance of that era, where every element of clothing and jewelry was carefully chosen to emphasize individuality and independence.\u003c\/p\u003e\n\u003cp\u003eThis is not just an ordinary ring; it's a story of a woman entering a ballroom in a long gown, smiling mysteriously, self-assured and ready to conquer the world. Art Deco jewelry is a tribute to courage, sophistication, and modernity, and these values are inscribed in the brilliance of this unique jewel.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 750 \/ 16","offer_id":56786297192783,"sku":"0030000401","price":7590.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0030000401Zlotypierscionekzdiamentamiirubinami_ArtDeco_2.webp?v=1767960744"},{"product_id":"zloty-pierscionek-w-formie-kwiatu-z-brylantami-1-80-ct-vintage","title":"Gold flower ring with diamonds 1.80 ct, Vintage","description":"\u003cp data-end=\"470\" data-start=\"0\"\u003e\u003cspan\u003eThe absolutely original and unique design of this ring, resembling a diamond flower on a golden stem encircling the finger. The setting of the brilliant-cut diamonds makes them move, like a summer breeze blowing in a meadow and stirring flower petals. Made in the second half of the 20th century from high-quality 18-karat gold. The ring is adorned with 10 white brilliant-cut diamonds, sparkling more brightly than the rays of the rising sun over the Loire. \u003c\/span\u003e\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow gold 0.750 \/ 10","offer_id":56786610979151,"sku":"0020003051","price":65500.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/Zlotypierscionekwformiekwiatuzbrylantami1.80ct_Vintage.png?v=1774960250"},{"product_id":"zloto-srebrny-pierscionek-z-diamentami-vintage-wlochy","title":"Gold and silver diamond ring, Vintage, Italy","description":"\u003cp\u003eThis unique ring is an example of classic Italian jewelry, combining high-grade gold (18K) and 0.800 silver – a characteristic duo for traditional jewelry from the turn of the 19th and 20th centuries, also preserved in some Italian workshop creations in later decades.\u003c\/p\u003e\n\u003cp\u003eAt its center is a round brilliant-cut diamond, set in a smooth crown, clear, with a distinct point of light. It is accompanied by smaller eight-cut diamonds, with a more subdued brilliance, giving the composition a shimmering effect known from historical cocktail and engagement rings.\u003c\/p\u003e\n\u003cp\u003eThe front of the ring is built on a vertical plane, with an ornamental structure resembling floral-arabesque motifs or stylized hearts. Rich but not exaggerated details are filled with precisely placed stones, creating an openwork, chiaroscuro composition. This type of arrangement recalls Edwardian rings and early Art Deco jewelry, yet retaining a classic Italian lightness of form.\u003c\/p\u003e\n\u003cp\u003eThe combination of a gold shank with a silver setting front was not only an aesthetic practice (silver harmonizes better with diamonds) but also a testament to the workshop's attention to detail. This ring was likely created in one of the Italian workshops specializing in hand-setting stones and historicizing styles.\u003c\/p\u003e\n\u003cp\u003eIdeal both as a collector's piece and an engagement ring with soul and character.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow gold 0.750 + Silver \/ 8","offer_id":56786634965327,"sku":"0030000505","price":4890.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0030000505Zloto-srebrnypierscionekzdiamentami_Vintage_Wlochy_1.webp?v=1767965634"},{"product_id":"zloty-pierscionek-toi-et-moi-z-diamentami-i-perla-z-i-pol-xx-wieku-paryz","title":"Toi et Moi gold ring with diamonds and a pearl, early 20th century, Paris","description":"\u003cp data-end=\"637\" data-start=\"264\"\u003e\u003cem\u003eToi et Moi\u003c\/em\u003e (Fr. \u003cem data-end=\"293\" data-start=\"284\"\u003eYou and Me\u003c\/em\u003e) is one of the most romantic ring styles, with a history dating back to the 18th century. It symbolizes the union of two people, with two stones set side by side representing two souls meeting in love. The most famous example of this design is the ring given by Napoleon Bonaparte to Joséphine de Beauharnais in 1796.\u003c\/p\u003e\n\u003cp data-end=\"1121\" data-start=\"639\"\u003eThe presented piece was created in Paris in the first half of the 20th century, during the flourishing of the Edwardian style, also known as the \u003cem data-end=\"794\" data-start=\"780\"\u003eBelle Époque\u003c\/em\u003e era. Jewelry of this period was characterized by exceptional lightness of form, flowing lines, and subtle elegance, reflecting a fascination with light, finesse, and the then-modern jewelry techniques. Parisian workshops were among the most important centers of European jewelry at the time, setting standards for luxury and sophistication.\u003c\/p\u003e\n\u003cp data-end=\"1682\" data-start=\"1123\"\u003eThe ring is made of 750-purity gold and combines an old-cut diamond and a white pearl, a duo particularly valued in Edwardian jewelry. The diamond, long considered an indestructible stone, is an allegory of permanence and fidelity, while the pearl is associated with purity, harmony, and subtle, almost ethereal beauty. The combination of these two stones, set in a delicate, softly modeled setting, creates a composition full of finesse and emotional depth, perfectly reflecting the spirit of French jewelry from the early 20th century.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow gold 750 \/ 13","offer_id":56787094634831,"sku":"0020004582","price":10990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020004582ZlotypierscionekToietMoizdiamentamiiperlazIpol.XXwieku_Paryz_1.webp?v=1767970979"},{"product_id":"zloty-pierscionek-z-perla-south-sea-i-brylantami-breguet","title":"Yellow gold ring with a South Sea pearl and diamonds, Breguet","description":"\u003cp\u003eThe \u003cem\u003eBreguet\u003c\/em\u003e ring is a blend of classic and modern, yet an expression of luxury and elegance. The focal point of this exceptional ring is a spherical South Sea pearl with a delicate pink overtone, exuding natural radiance and elegance. This pearl, known for its unique quality and beauty, is complemented by sparkling diamonds around it and on the wavy shank of the ring, adding subtle sparkle and unique charm.\u003c\/p\u003e\n\u003cp\u003eThe \u003cem\u003eBreguet\u003c\/em\u003e brand, known as one of the most prestigious and renowned in the world, is famous for its masterful craftsmanship and unparalleled quality of its products. Founded by Abraham-Louis Breguet in 1775, the brand has been at the forefront of innovation and excellence in watchmaking and jewelry for years. Its products are a symbol of luxury and prestige, enjoyed by both collectors and lovers of elegant accessories.\u003c\/p\u003e\n\u003cp\u003eSouth Sea pearls, originating mainly from the South-West Pacific region, are considered among the most coveted in the world. Their unique features, such as large size, luster, and variety of colors, make them extremely valued in the world of jewelry. South Sea pearls are a symbol of luxury and elegance, attracting attention with their natural beauty and exceptional radiance.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 750 \/ 12","offer_id":56787988152655,"sku":"0020003167","price":26990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020003167ZlotypierscionekzperlaSouthSeaibrylantami_Breguet_2.webp?v=1767971919"},{"product_id":"zloto-srebrny-pierscionek-z-diamentami-w-starych-szlifach-z-konca-xix-w","title":"Gold-and-silver ring with old-cut diamonds from the late 19th century.","description":"\u003cp\u003eAt the end of the 19th century, in an era when conversations about aesthetics and morality filled English drawing rooms, and the streets of London echoed with the clatter of horse hooves and the rustle of jacquard dress trains, jewelry was created that today is a rarity even among collectors.\u003c\/p\u003e\n\u003cp\u003eThe presented ring is made of 15-karat gold (0.614 purity), a standard almost exclusively used in Great Britain in the 19th century. Considering both the gold purity and the aesthetics of its craftsmanship, it can be assumed with high probability that the ring was made in England, most likely between 1885 and 1901, during the so-called \u003cem\u003eAesthetic Period\u003c\/em\u003e, a late phase of the Victorian era. \u0026nbsp; \u0026nbsp; \u0026nbsp; \u0026nbsp;\u003c\/p\u003e\n\u003cp\u003eThree diamonds in old cuts, brilliant and \u003cem\u003eOld Mine Cut,\u003c\/em\u003e arranged vertically, evoke associations with the passage of time. Perhaps they were meant to tell a story of the past, present, and future of the woman who wore it. The accompanying tiny stones in decorative grooves add lightness and finesse to the composition.\u003c\/p\u003e\n\u003cp\u003eThe setting's construction also draws attention: a combination of silver (to enhance the brilliance of the stones) with a durable gold body. Such a combination was both a practical and aesthetic solution; diamonds in a cool setting appear brighter, more luminous.\u003c\/p\u003e\n\u003cp\u003eThis is not just a ring; it is a piece of history enclosed in a form of utilitarian art, a testament to the mastery of the goldsmiths of the era, who did not use microscopes or lasers, but only a magnifying glass, daylight, and an extraordinary sense of composition.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow Gold 0.614 + Silver \/ 16","offer_id":56788201472335,"sku":"0020004531","price":50990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/pierscionekzdiamentamiwstarychszlifachzkoncaxixw._zloto0_614_15k_0020004531_2__beztla.webp?v=1767972457"},{"product_id":"zloty-pierscionek-zareczynowy-tacori-z-brylantem-1-65-ct-gia","title":"TACORI gold engagement ring with 1.65 ct diamond, GIA","description":"\u003cp\u003eThere are jewelry houses that build their recognition not only through stones but through the architecture of detail.\u003cspan\u003e \u003c\/span\u003e\u003cem\u003eTACORI\u003c\/em\u003e\u003cspan\u003e \u003c\/span\u003ebelongs to this group. The brand was founded in California, and its history began with the vision of Haig Tacorian – a designer who combined European goldsmithing tradition with American flair and technical perfectionism. To this day, every design bearing the Tacori name passes through the hands of the masters at the Los Angeles workshop, where manual finishing is as important as the diamond itself.\u003c\/p\u003e\n\u003cp\u003eThe presented engagement ring is a model personally designed by the brand's founder. The central 1.65 ct brilliant-cut diamond, in a classic \u003cem\u003eround brilliant\u003c\/em\u003e cut, has a GIA certificate, from the most rigorous gemological institute in the world. This document confirms the stone's parameters: its clarity, color, proportions, and cut quality. For a diamond of this size, the precision of the cut is of fundamental importance, determining the play of light, depth, and the stone's so-called fire.\u003c\/p\u003e\n\u003cp\u003eThe six-prong setting lifts the diamond high, allowing it to freely \"breathe\" with light. Beneath the crown lies \u003cem\u003eTACORI\u003c\/em\u003e's characteristic \"hidden bloom\" – a discreet halo of diamonds set just beneath the central stone. This detail is only visible from the profile, intended not for a distant observer, but for the person wearing the ring who knows its secret. \u003c\/p\u003e\n\u003cp\u003eThe band, made of 18-karat rose gold (750 hallmark), is pavé-set with brilliant-cut diamonds halfway along its length, and an additional, subtle accent of several stones is placed on the back of the shank, a discreet detail visible upon closer inspection. \u003c\/p\u003e\n\u003cp\u003eThis is a ring that combines Californian aesthetics with the jewelry discipline of the old continent. Refined in every cross-section – from the proportions of the crown, through the micropavé in the shank, to the construction of the setting – it was created with one of life's most important moments in mind.\u003c\/p\u003e\n\u003cp\u003eFor those seeking an engagement ring with a distinct design identity, confirmed stone quality, and craftsmanship on par with the world's leading jewelry houses, \u003cem\u003eTACORI\u003c\/em\u003e remains a conscious – and extremely consistent – choice.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Rose Gold 750 \/ 11","offer_id":57210866041167,"sku":"0020004898","price":49990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/ZlotypierscionekzareczynowyTACORIzbrylantem1.65ct_GIA_1.webp?v=1773145130"},{"product_id":"zloty-pierscionek-z-niebieskim-szklem-art-deco","title":"Gold ring with blue glass, Art Deco","description":"\u003cp\u003eIn the 1920s, city nights pulsed with neon lights, and jewelry store windows displayed sharp, decisive forms built on the rhythm of rectangles and stepped lines. This ring was created in that very spirit, when geometry became the language of modernity.\u003c\/p\u003e\n\u003cp\u003eThe central element is a deeply faceted, cobalt-colored glass with a rectangular cut and delicately beveled corners. The stone's surface interacts with light in an almost architectural manner, each plane reflecting it differently, creating an effect of internal mirrors. The intense shade of blue brings to mind the ink used to sign interwar contracts and letters written on creamy paper.\u003c\/p\u003e\n\u003cp\u003eThe setting, made of 585 yellow gold, was handcrafted with an attention to detail typical of the finest Art Deco workshops. It features clear, rhythmic incisions, subtle engravings with floral-geometric motifs, and stepped elements on the sides that organize the composition and give it a distinct, symmetrical frame. The openwork cutouts beneath the gallery not only lighten the form but also allow light to penetrate the glass, enhancing its depth.\u003c\/p\u003e\n\u003cp\u003eThis is an offering for those seeking jewelry with character—whether as a distinctive vintage-inspired engagement ring or a personal talisman for an anniversary or an important life stage. The geometric form ensures the ring sits well on the hand and attracts attention with its clean lines, while remaining comfortable for daily wear.\u003c\/p\u003e\n\u003cp\u003eThis ring does not speak of nostalgia. It speaks of courage in form, of a time when jewelry became a manifesto of modern style—and still can be.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow gold 585 \/ 13","offer_id":57211822473551,"sku":"0020004886","price":1990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/Zlotypierscionekzniebieskimszklem_ArtDeco_2.webp?v=1773155805"},{"product_id":"zloty-pierscionek-z-brylantem-w-starym-szlifie-polska-1920-1931-r","title":"Old-cut diamond ring in gold. Poland, 1920-1931.","description":"\u003cp\u003eRing made of 583 hallmark yellow gold with a stone setting in silver, dated 1920–1931. It bears Polish assay marks from the period when the District Assay Office in Krakow was operating, which confirms its origin and period of creation.\u003c\/p\u003e\n\u003cp\u003eThe central diamond is set in a silver bezel setting, characteristic of jewelry from the turn of the 19th and 20th centuries and the first decades of the 20th century. At that time, silver was often used for diamond settings – its bright color better highlighted the optical properties of the stones than yellow gold, and at the same time allowed for the precise execution of delicate details.\u003c\/p\u003e\n\u003cp\u003eThe stone has an old cut, typical for diamonds hand-cut before the popularization of modern brilliant proportions. Cuts of this type are characterized by a slightly higher crown, a smaller number of facets, and a softer, more dispersed play of light.\u003c\/p\u003e\n\u003cp\u003eThe form of the ring refers to Art Nouveau aesthetics, visible in the fluid, undulating line of the setting. The spiral motif surrounding the central stone creates a composition based on movement and asymmetry – a solution often found in jewelry inspired by natural, organic forms. Delicate decorations in the form of fine granulation and rhythmic incisions emphasize the handcrafted nature of the execution.\u003cbr\u003e\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow Gold 583 + Silver","offer_id":57216493519183,"sku":"0020004823","price":1790.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/0020004823Zlotypierscionekzbrylantemwstarymszlifie.Polska_1920-1931r._3.webp?v=1773226858"},{"product_id":"zloty-pierscionek-zareczynowy-syncret-classy-z-brylantem-0-90-ct-gia","title":"Syncret Classy Yellow Gold Engagement Ring with a 0.90 ct GIA Diamond","description":"\u003cp\u003eIn some engagement rings, the most important element is the story hidden within their proportions. Just one stone and a few grams of gold are enough to create a form that has remained a symbol of one of life's most significant moments for over a hundred years.\u003c\/p\u003e\n\u003cp\u003eThe \u003cem\u003eSyncret Classy\u003c\/em\u003e model was created precisely from this way of thinking about jewelry. The central point of the composition is a natural brilliant-cut diamond weighing 0.90 ct, whose quality is confirmed by a GIA certificate. Set in six white gold claws, the stone rises above the band like a small dome of light. This setting is not accidental; it allows the diamond to absorb and disperse every ray of light that hits its 58 facets.\u003c\/p\u003e\n\u003cp\u003eThe combination of white and yellow gold emphasizes the architecture of this form. The white gold crown draws attention to the brilliant-cut diamond, while the slender, polished yellow gold band remains a calm, classic background for the entire composition. As a result, the whole piece maintains the proportions known from the most exquisite solitaire ring designs.\u003c\/p\u003e\n\u003cp\u003eThe ring was designed and handcrafted in our jewelry workshop, where jewelers, gemologists, and art historians work on every project. For over twenty years, we have been developing our original collections and creating custom-made jewelry, from engagement rings to wedding bands and family heirlooms.\u003c\/p\u003e\n\u003cp\u003eIn the case of this model, everything comes down to one element: a brilliant-cut diamond of nearly a carat becomes the center of the entire story. The rest of the form is designed to let it speak with its own light.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Yellow gold 585 \/ 14","offer_id":57231675031887,"sku":"0020004896","price":18990.0,"currency_code":"PLN","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/ZlotypierscionekzareczynowySyncretClassyzbrylantem0.90ctGIA_2.png?v=1774960101"},{"product_id":"zloty-pierscionek-z-brylantami-w-starych-szlifach-wieden-pol-xx-w","title":"Gold ring with old cut diamonds, Vienna, mid-20th century.","description":"\u003cp\u003eThere are jewelry compositions in which the eye does not stop at a single stone. It wanders. From one sparkle to another, along the soft line of the setting, following the rhythm of old cuts, along the delicately curved band of smaller diamonds, which binds the whole like an ornate ribbon on an evening gown. This Viennese ring was conceived precisely in this way, not as a single accent, but as a small architecture of light. Diamonds with old cuts give a more shimmering brilliance than modern ones: less \"technical\", but deeper, full of soft reflections and life visible with every movement of the hand.\u003c\/p\u003e\n\u003cp\u003eThe setting is made of 585 white gold, and the form itself fits very well into the aesthetic of the mid-20th century, when jewelers eagerly embraced winding, ribbon-like, and asymmetrical motifs, without abandoning the elegance inherited from earlier eras. The central band of smaller diamonds, enclosed in a subtly millegrain frame, organizes the composition and adds sophistication. This is jewelry from Vienna, embodying the character of a city that for decades enjoyed combining decorativeness with formal discipline, without coldness, but with a great sense of proportion.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"White gold 585 \/ 11","offer_id":57232408445263,"sku":"0020004881","price":21490.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/Zlotypierscionekzbrylantamiwstarychszlifach_Wieden_pol.XXw._2.webp?v=1773418824"},{"product_id":"zloty-pierscionek-z-motywem-rozy-vintage","title":"Złoty pierścionek z motywem róży, Vintage","description":"\u003cp data-pm-slice=\"1 1 []\"\u003eRóża zatrzymana w momencie pełnego rozkwitu.\u003c\/p\u003e\n\u003cp\u003ePierścionek wykonany ręcznie ze złota o ciepłym odcieniu, z pełnoplastycznym przedstawieniem kwiatu i towarzyszących mu liści. Forma jest wyraźnie inspirowana naturą, realistyczna, miękka, niemal botaniczna, co było charakterystyczne dla drugiej połowy XIX wieku, kiedy jubilerzy coraz częściej odchodzili od czystej symboliki na rzecz obserwacji świata przyrody. Ten konkretny pierścionek najprawdopodobniej został wykonany w II poł. XX wieku, czerpiąc wzorce z poprzednich epok.\u003c\/p\u003e\n\u003cp\u003eTego typu biżuteria powstawała najczęściej w Europie Środkowej, w kręgu Austro-Węgier lub Niemiec, gdzie ceniono solidność formy i bardziej naturalistyczne ujęcie ornamentu.\u003c\/p\u003e\n\u003cp\u003eMotyw róży nie jest tu jedynie dekoracją. Od XIX wieku oznaczał miłość, ale w tej formie, rozwiniętej, niemal namacalnej - staje się czymś więcej: obecnością, emocją uchwyconą w materiale.\u003c\/p\u003e\n\u003cp\u003ePierścionek nosi się jak małą rzeźbę - wyraźny, ale organiczny, dobrze układający się na dłoni. Może funkcjonować jako pojedynczy, wyrazisty element lub kontrast dla bardziej minimalistycznych form.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Złoto żółte 540 \/ 15.5","offer_id":57550447477071,"sku":"0020004930","price":2990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/Zlotypierscionekzmotywemrozy_Vintage_2.webp?v=1776958276"},{"product_id":"zloty-pierscionek-z-trzema-diamentami-i-polowa-xx-w","title":"Złoty pierścionek z trzema diamentami, I połowa XX w.","description":"\u003cp data-start=\"0\" data-end=\"327\"\u003eTrzy diamenty ustawione obok siebie to motyw, który na początku XX wieku miał bardzo konkretną wymowę. Nie chodziło wyłącznie o kompozycję, taki układ odczytywano jako ciągłość: to, co było, to, co jest i to, co dopiero się wydarzy. Symbolika prosta, ale przez to trwała, często wybierana przy najważniejszych momentach życia.\u003c\/p\u003e\n\u003cp data-start=\"329\" data-end=\"636\"\u003eW tym pierścionku uwagę przyciągają same kamienie. Brylanty w starych szlifach nie dają jednolitego, ostrego błysku – ich światło jest bardziej rozproszone, migotliwe, chwilami wręcz przygaszone, by za moment znów się ożywić. To efekt ręcznego szlifowania i innych proporcji niż we współczesnych diamentach.\u003c\/p\u003e\n\u003cp data-start=\"638\" data-end=\"898\"\u003eOprawa została wykonana z wyczuciem proporcji. Delikatna obrączka z żółtego złota prowadzi ku górze, gdzie kamienie osadzono w jaśniejszej, subtelnie wyodrębnionej części. Dzięki temu diamenty zyskują więcej światła, a całość pozostaje lekka i dobrze wyważona.\u003c\/p\u003e\n\u003cp data-start=\"1067\" data-end=\"1272\"\u003eTo jeden z tych modeli, w których forma i znaczenie idą w parze. Bez nadmiaru dekoracji, skupiony na tym, co najważniejsze: trzech kamieniach i historii, którą od ponad stu lat opowiadają w ten sam sposób.\u003c\/p\u003e","brand":"Syncret","offers":[{"title":"Złoto żółte 750 \/ 12.5","offer_id":57576425914703,"sku":"0020004869","price":6990.0,"currency_code":"PLN","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0961\/5566\/4719\/files\/Zlotypierscionekztrzemadiamentami_Ipol.XXw._2.webp?v=1777295754"}],"url":"https:\/\/syncret.com\/en\/collections\/pierscionki-zareczynowe-dawne.oembed?page=2","provider":"syncret","version":"1.0","type":"link"}